Structure of PDB 6sl5 Chain K

Receptor sequence

>6sl5K (length=84) Species: 3046 (Dunaliella salina)

GQSGSVRAIMVSSIGACLFASRFGLAPSVRKNATAAGTDLEKSVHAAGDD
PGAGFTATDVLAMGAAGHAIGVGEWLAQLARGGV

3D structure

• PDB: 6sl5 Structure and energy transfer pathways of the Dunaliella Salina photosystem I supercomplex.
• Chain: K
• Resolution: 2.84 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	K	G92 L95	G73 L76
BS02	CLA	K	N51 A52 I89	N32 A33 I70
BS03	CLA	K	R26 M29 V30	R7 M10 V11
BS04	CLA	K	I89 E93 A96	I70 E74 A77
BS05	CLA	K	A35 A55 G56	A16 A36 G37
BS06	CLA	K	L37 F38 R41 D68 D69 P70 F74	L18 F19 R22 D49 D50 P51 F55

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Dec 2 20:30:14 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6sl5', asym_id = 'K', title = 'Structure and energy transfer pathways of the Dunaliella Salina photosystem I supercomplex.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6sl5', asym_id='K', title='Structure and energy transfer pathways of the Dunaliella Salina photosystem I supercomplex.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009522,0015979,0016020', uniprot = '', pdbid = '6sl5', asym_id = 'K'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009522,0015979,0016020', uniprot='', pdbid='6sl5', asym_id='K')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>