Structure of PDB 6rkd Chain K

Receptor sequence

>6rkdK (length=271) Species: 322710 (Azotobacter vinelandii DJ) [Search protein sequence]

NSIKHVISPLARQTLQDRDLTRPVAGKRPIRLLPWLQVVKIGGRVMDRGA
DAILPLVEELRKLLPEHRLLILTGAGVRARHVFSVGLDLGLPVGSLAPLA
ASEAGQNGHILAAMLASEGVSYVEHPTVADQLAIHLSATRAVVGSAFPPY
HHHEFPGSRIPPHRADTGAFLLADAFGAAGLTIVENVDGIYTADPNGPDR
GQARFLPETSATDLAKSEGPLPVDRALLDVMATARHIERVQVVNGLVPGR
LTAALRGEHVGTLIRTGVRPA

3D structure

PDB

6rkd Molybdate pumping into the molybdenum storage protein via an ATP-powered piercing mechanism.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	OMO	K	Q136 H140	Q131 H135
BS02	ATP	K	K45 G47 G48 R49 G79 A80 E190 N191 V192 Y196 A198 D199 P200 P225 L226 P227	K40 G42 G43 R44 G74 A75 E185 N186 V187 Y191 A193 D194 P195 P220 L221 P222
BS03	MG	K	E190 P227	E185 P222
BS04	8M0	K	P103 A106 S107 G110 H114 E129 H130 P154 H156	P98 A101 S102 G105 H109 E124 H125 P149 H151
BS05	J8E	K	E129 P131	E124 P126
BS06	8M0	K	H156 H157 H158	H151 H152 H153

Gene Ontology

	Molecular Function
GO:0030151	molybdenum ion binding
GO:0045735	nutrient reservoir activity
GO:0046872	metal ion binding

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:6rkd, PDBe:6rkd, PDBj:6rkd
PDBsum	6rkd
PubMed	31811022
UniProt	P84308\|MOSA_AZOVD Molybdenum storage protein subunit alpha (Gene Name=mosA)

[Back to BioLiP]