Structure of PDB 6qx9 Chain K

Receptor sequence
>6qx9K (length=322) Species: 9606 (Homo sapiens) [Search protein sequence]
RVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELM
QKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPLSMNLR
EVLKKYGKDVGLHIKAVRSYSQQLFLALKLLKRCNILHADIKPDNILVNE
SKTILKLCDFGSASHVADNDITPYLVSRFYRAPEIIIGKSYDYGIDMWSV
GCTLYELYTGKILFPGKTNNHMLKLAMDLKGKMPNKMIRKGVFKDQHFDQ
NLNFMYIEVDREKVTVMSTINPTKDLLADLILPEDQRKKVHQLKDLLDQI
LMLDPAKRISINQALQHAFIQE
3D structure
PDB6qx9 Mechanism of 5' splice site transfer for human spliceosome activation.
ChainK
Resolution3.28 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D815 K817 N820 D834 S852
Catalytic site (residue number reindexed from 1) D140 K142 N145 D159 S177
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K K911 K915 K236 K240
BS02 rna K N910 R914 K990 N235 R239 K307
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0044024 histone H2AS1 kinase activity
GO:0106310 protein serine kinase activity
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006338 chromatin remodeling
GO:0006397 mRNA processing
GO:0006468 protein phosphorylation
GO:0008380 RNA splicing
GO:0016310 phosphorylation
GO:0035332 positive regulation of hippo signaling
GO:0045292 mRNA cis splicing, via spliceosome
GO:0046827 positive regulation of protein export from nucleus
GO:0090266 regulation of mitotic cell cycle spindle assembly checkpoint
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005694 chromosome
GO:0016607 nuclear speck
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6qx9, PDBe:6qx9, PDBj:6qx9
PDBsum6qx9
PubMed30975767
UniProtQ13523|PRP4K_HUMAN Serine/threonine-protein kinase PRP4 homolog (Gene Name=PRP4K)

[Back to BioLiP]