Structure of PDB 6pfy Chain K

Receptor sequence
>6pfyK (length=46) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
ILCNLFAIALGRYIQSRGKGPGLGLPELLATTSFGHLLAAGVVSGL
3D structure
PDB6pfy Membrane protein megahertz crystallography at the European XFEL.
ChainK
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K E58 S64 E27 S33
BS02 CLA K Q35 R37 Q15 R17
BS03 CLA K I20 C22 F25 H67 I1 C3 F6 H36
BS04 CLA K L69 G72 G76 L38 G41 G45
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6pfy, PDBe:6pfy, PDBj:6pfy
PDBsum6pfy
PubMed31685819
UniProtP0A425|PSAK_THEVB Photosystem I reaction center subunit PsaK (Gene Name=psaK)

[Back to BioLiP]