Structure of PDB 6ocp Chain K |
>6ocpK (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] |
SFPEVVELNVGGQVYFTRHSTLISIPHSLLWKMFSLAKDSKGRFFIDRDG FLFRYILDYLRDRQVVLPDHFPEKGRLKREAEYFQLPDLVKLLT |
|
PDB | 6ocp Structural basis for auxiliary subunit KCTD16 regulation of the GABABreceptor. |
Chain | K |
Resolution | 2.35 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
K |
Q34 G79 F80 R83 |
Q13 G50 F51 R54 |
|
|
|
|