Structure of PDB 6o8y Chain K

Receptor sequence

>6o8yK (length=145) Species: 1351 (Enterococcus faecalis) [Search protein sequence]

MRTTYMAKAGEVERKWYVVDATDVPLGRLSAVVASVLRGKNKPTFTPHVD
TGDFVIVINADKVKLTGKKATDKIYYRHSMYPGGLKSVTAGELRDKNSRR
LIETSVKGMLPKNTLGRKQFTKLNVYGGAEHPHAAQQPEVLDITN

3D structure

PDB

6o8y Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.

Chain

Resolution

4.14 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	R2 M6 K8 P25 R28 R38 K40 P47 H48 T66 K69 K73 Y76 R77 H78 S79 Y81 K86 G108 M109 P111 K112 N113 T114 L115 R117 P132 H133 A135 Q136	R2 M6 K8 P25 R28 R38 K40 P47 H48 T66 K69 K73 Y76 R77 H78 S79 Y81 K86 G108 M109 P111 K112 N113 T114 L115 R117 P132 H133 A135 Q136

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links