Structure of PDB 6nwa Chain K

Receptor sequence
>6nwaK (length=70) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
LSWSPKVAGVMIACNILAIAFGKLTIKQQNVGTPMPSSNFFGGFGLGAVL
GTASFGHILGAGVILGLANM
3D structure
PDB6nwa The structure of the stress-induced photosystem I-IsiA antenna supercomplex.
ChainK
Resolution3.48 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K L63 G64 L50 G51
BS02 CLA K F34 T38 F21 T25
BS03 CLA K A21 M24 I25 N28 H70 A8 M11 I12 N15 H57
BS04 CLA K G75 G79 N82 G62 G66 N69
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6nwa, PDBe:6nwa, PDBj:6nwa
PDBsum6nwa
PubMed31133699
UniProtP72712|PSAK1_SYNY3 Photosystem I reaction center subunit PsaK 1 (Gene Name=psaK1)

[Back to BioLiP]