Structure of PDB 6nf8 Chain K

Receptor sequence
>6nf8K (length=136) Species: 9913 (Bos taurus) [Search protein sequence]
SFSIYPPIPGQESSLRWAGKKFEEIPIAHIKASYNNTQIHVVSAAHQPLA
RASCGTEGFRNAKKGTGIAAQTAGIAAAAKATGKGVTHVRVVVKGLGPGR
LSAIKGLTMGGLEVISITDNTPIPHNGCRPRKARRL
3D structure
PDB6nf8 Structure of Human Mitochondrial Translation Initiation Factor 3 Bound to the Small Ribosomal Subunit.
ChainK
Resolution3.48 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K H90 N96 N97 Q99 H101 H107 P109 R112 R121 N122 A123 K125 K155 P185 H186 N187 G188 C189 R190 R192 K193 R195 L197 H29 N35 N36 Q38 H40 H46 P48 R51 R60 N61 A62 K64 K94 P124 H125 N126 G127 C128 R129 R131 K132 R134 L136
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
GO:0043043 peptide biosynthetic process
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6nf8, PDBe:6nf8, PDBj:6nf8
PDBsum6nf8
PubMed30677741
UniProtP82911|RT11_BOVIN Small ribosomal subunit protein uS11m (Gene Name=MRPS11)

[Back to BioLiP]