Structure of PDB 6n7x Chain K

Receptor sequence

>6n7xK (length=124) Species: 559292 (Saccharomyces cerevisiae S288C)

KIQVAHSSRLANLIDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIEER
VPKTQLDKLRPRTLNIKVEKRVLGLTILRGEQILSTVVEDKPLLSKKERL
VRDKKEKKQAQKQTKLRKEKEKKP

3D structure

• PDB: 6n7x CryoEM structure of Saccharomyces cerevisiae U1 snRNP offers insight into alternative splicing.
• Chain: K
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	H8 H40 T56 Q57 K60 R88 K105 K117 Q120 K121 E128	H6 H38 T54 Q55 K58 R79 K96 K108 Q111 K112 E119

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0070990 snRNP binding

Biological Process

• GO:0000245 spliceosomal complex assembly
• GO:0000387 spliceosomal snRNP assembly
• GO:0000395 mRNA 5'-splice site recognition
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0036261 7-methylguanosine cap hypermethylation
• GO:1903241 U2-type prespliceosome assembly

Cellular Component

• GO:0000243 commitment complex
• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005682 U5 snRNP
• GO:0005685 U1 snRNP
• GO:0005686 U2 snRNP
• GO:0005687 U4 snRNP
• GO:0005737 cytoplasm
• GO:0032991 protein-containing complex
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071001 U4/U6 snRNP
• GO:0071004 U2-type prespliceosome
• GO:0071013 catalytic step 2 spliceosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6n7x, PDBe:6n7x, PDBj:6n7x
• PDBsum: 6n7x
• PubMed: 29051543
• UniProt: P40018|RSMB_YEAST Small nuclear ribonucleoprotein-associated protein B (Gene Name=SMB1)