Structure of PDB 6k1p Chain K

Receptor sequence

>6k1pK (length=463) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

QFRESPAYVNGQLRPYQIQGVNWLVSLHKNKIAGILADEMGLGKTLQTIS
FLGYLRYIEKIPGPFLVIAPKSTLNNWLREINRWTPDVNAFILQGDKEER
AELIQKKLLGCDFDVVIASYEIIIREKSPLKKINWEYIIIDEAHRIKNEE
SMLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLPDIFSDAQDFDD
WFSSESTEEDQDKIVKQLHTVLQPFLLRRIKSDVETSLLPKKELNLYVGM
SSMQKKWYKKILEKDESKTRLLNIMMQLRKCCNHPYLFDGAEPGPPYTTD
EHLVYNAAKLQVLDKLLKKLKEEGSRVLIFSQMSRLLDILEDYCYFRNYE
YCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLGINLTSADVVV
LYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKL
RLDQLVIQQNRTS

3D structure

PDB

6k1p Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.

Chain

Resolution

3.87 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.4.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	K	R328 K330 S334 M335 W600 N601	R145 K147 S151 M152 W406 N407
BS02	dna	K	K254 K280 R283 E304 I305 M470 K474 M527 S528 G550 R557 T577	K71 K97 R100 E121 I122 M276 K280 M333 S334 G356 R363 T383
BS03	BEF	K	E325 G584 R611	E142 G390 R417
BS04	ADP	K	M223 G224 G226 K227 T228 L229 N586 R614	M40 G41 G43 K44 T45 L46 N392 R420

Gene Ontology

	Molecular Function
GO:0000182	rDNA binding
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003730	mRNA 3'-UTR binding
GO:0004386	helicase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0008094	ATP-dependent activity, acting on DNA
GO:0016787	hydrolase activity
GO:0016887	ATP hydrolysis activity
GO:0031491	nucleosome binding
GO:0140658	ATP-dependent chromatin remodeler activity

	Biological Process
GO:0001178	regulation of transcriptional start site selection at RNA polymerase II promoter
GO:0006325	chromatin organization
GO:0006338	chromatin remodeling
GO:0006354	DNA-templated transcription elongation
GO:0006355	regulation of DNA-templated transcription
GO:0006363	termination of RNA polymerase I transcription
GO:0006369	termination of RNA polymerase II transcription
GO:0007062	sister chromatid cohesion
GO:0009408	response to heat
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0046832	negative regulation of RNA export from nucleus
GO:1902275	regulation of chromatin organization
GO:1903895	negative regulation of IRE1-mediated unfolded protein response

	Cellular Component
GO:0005634	nucleus
GO:0016587	Isw1 complex
GO:0030874	nucleolar chromatin
GO:0036436	Isw1a complex
GO:0036437	Isw1b complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6k1p, PDBe:6k1p, PDBj:6k1p
PDBsum	6k1p
PubMed	30872815
UniProt	P38144\|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 (Gene Name=ISW1)

[Back to BioLiP]