Structure of PDB 6ijj Chain K

Receptor sequence
>6ijjK (length=85) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
FIGSSTNLIMVASTTATLAAARFGLAPTVKKNTTAGLKLVDSKNSAGVIS
NDPAGFTIVDVLAMGAAGHGLGVGIVLGLKGIGAL
3D structure
PDB6ijj Antenna arrangement and energy transfer pathways of a green algal photosystem-I-LHCI supercomplex.
ChainK
Resolution2.89 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K V134 L137 A138 V59 L62 A63
BS02 CLA K N107 T108 N32 T33
BS03 CLA K R97 F98 S125 N126 D127 P128 F131 I133 R22 F23 S50 N51 D52 P53 F56 I58
BS04 CLA K G149 G153 G74 G78
BS05 CLA K F76 N82 M85 V86 T89 T90 H144 F1 N7 M10 V11 T14 T15 H69
BS06 CLA K A91 A95 L100 A101 L112 A16 A20 L25 A26 L37
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ijj, PDBe:6ijj, PDBj:6ijj
PDBsum6ijj
PubMed30850819
UniProtP14225|PSAK_CHLRE Photosystem I reaction center subunit psaK, chloroplastic (Gene Name=PSAK)

[Back to BioLiP]