Structure of PDB 6i9r Chain K

Receptor sequence
>6i9rK (length=177) Species: 9606 (Homo sapiens) [Search protein sequence]
SSFSRAPQQWATFARIWYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALS
DCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPV
AIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKI
PKRLDEYTQEEIDAFPRLWTPPEDYRL
3D structure
PDB6i9r Inhibition of mitochondrial translation suppresses glioblastoma stem cell growth.
ChainK
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K P27 G29 K30 L50 S68 K71 K75 Y77 S78 H80 F87 Q94 R98 Y109 G110 M111 K114 N115 L116 H117 R119 Y176 R177 P26 G28 K29 L49 S67 K70 K74 Y76 S77 H79 F86 Q93 R97 Y108 G109 M110 K113 N114 L115 H116 R118 Y175 R176
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0017148 negative regulation of translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6i9r, PDBe:6i9r, PDBj:6i9r
PDBsum6i9r
PubMed33910005
UniProtQ9BYD1|RM13_HUMAN Large ribosomal subunit protein uL13m (Gene Name=MRPL13)

[Back to BioLiP]