Structure of PDB 6gmn Chain K |
>6gmnK (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] |
MMYVKLISSDGHEFIVKREHALTSGTIKAMLTNEVNFREIPSHVLSKVCM YFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC |
|
PDB | 6gmn Surface Probing by Fragment-Based Screening and Computational Methods Identifies Ligandable Pockets on the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase. |
Chain | K |
Resolution | 1.94 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
F4E |
K |
E64 I65 E102 M105 |
E39 I40 E77 M80 |
|
|
|
|