Structure of PDB 6es2 Chain K

Receptor sequence
>6es2K (length=70) Species: 9606 (Homo sapiens) [Search protein sequence]
DKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQN
RRAKERKINKKKLQQQQQQQ
3D structure
PDB6es2 Two distinct DNA sequences recognized by transcription factors represent enthalpy and entropy optima.
ChainK
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna K R190 V191 Y193 R198 R228 Q229 I232 N236 R4 V5 Y7 R12 R42 Q43 I46 N50 PDBbind-CN: Kd=0.105uM
BS02 dna K Y189 R190 Q235 R238 R242 Y3 R4 Q49 R52 R56 PDBbind-CN: Kd=0.105uM
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6es2, PDBe:6es2, PDBj:6es2
PDBsum6es2
PubMed29638214
UniProtQ99626|CDX2_HUMAN Homeobox protein CDX-2 (Gene Name=CDX2)

[Back to BioLiP]