Structure of PDB 6dhh Chain K

Receptor sequence
>6dhhK (length=37) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
3D structure
PDB6dhh Structures of the intermediates of Kok's photosynthetic water oxidation clock.
ChainK
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide K V24 L35 W39 R46 V15 L26 W30 R37
BS02 CLA K P29 L33 P20 L24
BS03 CLA K F32 W39 Q40 F23 W30 Q31
Gene Ontology
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6dhh, PDBe:6dhh, PDBj:6dhh
PDBsum6dhh
PubMed30405241
UniProtQ9F1K9|PSBK_THEVB Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]