Structure of PDB 6cb1 Chain K

Receptor sequence
>6cb1K (length=260) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
AIPRERVIKAVNELIKFTSKPKNLLEDDEEELKKDLQLIVVNNKSFTGTS
KSFKLKLLNVKHSFYKPWKEASATAVKDFKVLLILKDSDIKKVSEDDLFD
QLDSEGIKVDEIICGKDLKTVYKAYEARNAFISQFSLILADDSIVTSLPK
LMGGKAYNKVETTPISIRTHANKEFSLTTLTNNIKKVYMNQLPVKLPRGT
TLNVHLGNLEWLRPEEFVDNVELISEQLIKAYQIRSIFIKTNRSPVLPLY
YNQDVLDELE
3D structure
PDB6cb1 Modular assembly of the nucleolar pre-60S ribosomal subunit.
ChainK
Resolution4.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K K93 F95 K96 K161 A166 Y167 E168 D184 S185 I186 T188 S189 G195 G196 Y199 A213 P239 R240 G241 T243 N284 S286 P287 K51 F53 K54 K119 A124 Y125 E126 D142 S143 I144 T146 S147 G153 G154 Y157 A171 P197 R198 G199 T201 N242 S244 P245
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:0070180 large ribosomal subunit rRNA binding
GO:0070628 proteasome binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0030163 protein catabolic process
GO:0042254 ribosome biogenesis
Cellular Component
GO:0000502 proteasome complex
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6cb1, PDBe:6cb1, PDBj:6cb1
PDBsum6cb1
PubMed29512650
UniProtP38779|CIC1_YEAST Proteasome-interacting protein CIC1 (Gene Name=CIC1)

[Back to BioLiP]