Structure of PDB 6boh Chain K

Receptor sequence

>6bohK (length=140) Species: 262724 (Thermus thermophilus HB27)

MKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGD
FVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLE
HAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV

3D structure

• PDB: 6boh Conformational Control of Translation Termination on the 70S Ribosome.
• Chain: K
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	M1 K2 T3 W13 T22 L23 G24 R25 T28 R35 K37 P44 N45 F51 T63 G64 K65 K66 Q69 R74 Y75 S76 Y78 P79 G80 L82 K83 R97 E100 A102 G105 M106 P108 P111 L112 R114 K118 H130 Q133	M1 K2 T3 W13 T22 L23 G24 R25 T28 R35 K37 P44 N45 F51 T63 G64 K65 K66 Q69 R74 Y75 S76 Y78 P79 G80 L82 K83 R97 E100 A102 G105 M106 P108 P111 L112 R114 K118 H130 Q133
BS02	MG	K	D127 Q131	D127 Q131

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6boh, PDBe:6boh, PDBj:6boh
• PDBsum: 6boh
• PubMed: 29731232
• UniProt: Q72IN1|RL13_THET2 Large ribosomal subunit protein uL13 (Gene Name=rplM)