Structure of PDB 6b4v Chain K

Receptor sequence

>6b4vK (length=140) Species: 262724 (Thermus thermophilus HB27)

MKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGD
FVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLE
HAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV

3D structure

• PDB: 6b4v Mechanism of Inhibition of Translation Termination by Blasticidin S.
• Chain: K
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	K2 T3 G24 R25 T28 T32 R35 K37 N45 F51 T63 K66 K70 R74 Y75 S76 Y78 P79 L82 K83 K89 E100 H101 A102 G105 M106 P108 K109 P111 L112 R114 K118 Q133	K2 T3 G24 R25 T28 T32 R35 K37 N45 F51 T63 K66 K70 R74 Y75 S76 Y78 P79 L82 K83 K89 E100 H101 A102 G105 M106 P108 K109 P111 L112 R114 K118 Q133
BS02	MG	K	G64 K65 L67	G64 K65 L67

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6b4v, PDBe:6b4v, PDBj:6b4v
• PDBsum: 6b4v
• PubMed: 29366636
• UniProt: Q72IN1|RL13_THET2 Large ribosomal subunit protein uL13 (Gene Name=rplM)