Structure of PDB 6az3 Chain K

Receptor sequence
>6az3K (length=149) Species: 5661 (Leishmania donovani) [Search protein sequence]
KSHYICAGRLVRILRGPRQDRVGVIVDIVDANRVLVENPEDAKMWRHVQN
LKNVEPLKYCVSVSRNCSAKALKDALASSKALEKYAKTRTAARVEAKKAC
AASTDFERYQLRVARRSRAHWARKVFDEKDAKTPVSWHKVALKKMQKKA
3D structure
PDB6az3 Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.
ChainK
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K R75 P77 R78 N92 K103 W105 H107 V108 N110 N113 N126 R15 P17 R18 N32 K43 W45 H47 V48 N50 N53 N66
BS02 rna K Y64 C66 R69 K118 T148 R149 T150 R153 K157 R172 V173 R176 H180 W181 R183 W197 Y4 C6 R9 K58 T88 R89 T90 R93 K97 R112 V113 R116 H120 W121 R123 W137
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6az3, PDBe:6az3, PDBj:6az3
PDBsum6az3
PubMed29150609
UniProtQ25278|RL14_LEIDO Large ribosomal subunit protein eL14 (Gene Name=RPL14)

[Back to BioLiP]