Structure of PDB 6ahu Chain K

Receptor sequence
>6ahuK (length=121) Species: 9606 (Homo sapiens) [Search protein sequence]
PVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLVLRR
DPSVKRTLCRGCSSLLVPGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLN
DPGHLLWGDRPEAQLGSQADS
3D structure
PDB6ahu Cryo-EM Structure of the Human Ribonuclease P Holoenzyme.
ChainK
Resolution3.66 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.26.5: ribonuclease P.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K R52 K58 R63 T76 R78 R80 R81 C82 R83 R86 W87 S98 R100 F101 L102 P105 H107 W110 G111 R113 R49 K55 R60 T73 R75 R77 R78 C79 R80 R83 W84 S95 R97 F98 L99 P102 H104 W107 G108 R110
BS02 rna K K47 R48 V50 K44 R45 V47
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004526 ribonuclease P activity
GO:0005515 protein binding
GO:0033204 ribonuclease P RNA binding
GO:0046872 metal ion binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006396 RNA processing
GO:0008033 tRNA processing
GO:0009410 response to xenobiotic stimulus
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005655 nucleolar ribonuclease P complex
GO:0005730 nucleolus
GO:0030681 multimeric ribonuclease P complex
GO:1902555 endoribonuclease complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ahu, PDBe:6ahu, PDBj:6ahu
PDBsum6ahu
PubMed30454648
UniProtQ9H633|RPP21_HUMAN Ribonuclease P protein subunit p21 (Gene Name=RPP21)

[Back to BioLiP]