Structure of PDB 5ylz Chain K

Receptor sequence
>5ylzK (length=96) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
DQLAKLSYEKTLRNLATQTQNSSKQDKVQKDTKTGKITIADDDKLVNKLA
VSLQSESKKRYEARKRQMQNAKTLYGVESFINDKNKQFNEKLSRES
3D structure
PDB5ylz Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
ChainK
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K S104 K107 R175 Y176 R179 S7 K10 R60 Y61 R64
BS02 rna K T114 K174 R179 R181 K199 Q202 F203 K206 R209 T17 K59 R64 R66 K84 Q87 F88 K91 R94
Gene Ontology
Molecular Function
GO:0000384 first spliceosomal transesterification activity
GO:0000386 second spliceosomal transesterification activity
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005829 cytosol
GO:0071004 U2-type prespliceosome
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071008 U2-type post-mRNA release spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ylz, PDBe:5ylz, PDBj:5ylz
PDBsum5ylz
PubMed29153833
UniProtP53277|SYF2_YEAST Pre-mRNA-splicing factor SYF2 (Gene Name=SYF2)

[Back to BioLiP]