Structure of PDB 5x8p Chain K

Receptor sequence

>5x8pK (length=193) Species: 3562 (Spinacia oleracea)

STKCTEEWRQLKEAVKKEFAIPHVPLDQRWMFTLEEATGPDIWNTTWYPK
SADHVPTDKKWYVVDATDLILGRMASTIAIHIRGKNLASYTPSVDMGAFV
IVVNADKVAVSGKKRTQKLYRRHSGRPGGLKEETFDQLQKRIPERIIEHA
VRGMLPKGRLGRYLFNHLKVYKGAEHPHQAQQPIDLPLRDKRI

3D structure

• PDB: 5x8p Unique localization of the plastid-specific ribosomal proteins in the chloroplast ribosome small subunit provides mechanistic insights into the chloroplastic translation
• Chain: K
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	T110 A233 Q235	T57 A180 Q182
BS02	rna	K	T91 G92 P93 T98 T99 Y101 K103 S104 P109 W114 L124 G125 R126 S129 K138 P145 S146 F152 S164 K167 Y173 R174 H176 R179 P180 G181 R194 E201 H202 A203 R205 G206 M207 P209 K210 R212 L213 R215 Y216 N219 K222 H231 D243 R245	T38 G39 P40 T45 T46 Y48 K50 S51 P56 W61 L71 G72 R73 S76 K85 P92 S93 F99 S111 K114 Y120 R121 H123 R126 P127 G128 R141 E148 H149 A150 R152 G153 M154 P156 K157 R159 L160 R162 Y163 N166 K169 H178 D190 R192

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:5x8p, PDBe:5x8p, PDBj:5x8p
• PDBsum: 5x8p
• PubMed: 28582576
• UniProt: P12629|RK13_SPIOL Large ribosomal subunit protein uL13c (Gene Name=RPL13)