Structure of PDB 5wcu Chain K

Receptor sequence
>5wcuK (length=98) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB5wcu Revisit of Reconstituted 30-nm Nucleosome Arrays Reveals an Ensemble of Dynamic Structures.
ChainK
Resolution5.53 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna K H39 R40 Y41 R42 P43 R72 R83 F84 Q85 V117 T118 H2 R3 Y4 R5 P6 R35 R46 F47 Q48 V80 T81
BS02 dna K R40 Y41 V46 R49 R63 L65 R83 K115 R3 Y4 V9 R12 R26 L28 R46 K78
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5wcu, PDBe:5wcu, PDBj:5wcu
PDBsum5wcu
PubMed29959925
UniProtP02299|H3_DROME Histone H3 (Gene Name=His3)

[Back to BioLiP]