Structure of PDB 5v93 Chain K

Receptor sequence
>5v93K (length=121) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
IQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGGN
VKRGDVVKAVVVRTVKERRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGP
VGRELREKRFMKIISLAPEVL
3D structure
PDB5v93 Structural insights into species-specific features of the ribosome from the human pathogen Mycobacterium tuberculosis.
ChainK
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K Q3 E5 S6 R7 I22 R23 S28 S29 R31 Y32 T42 K44 R54 G55 K67 E68 R70 Y76 R110 Q2 E4 S5 R6 I21 R22 S27 S28 R30 Y31 T41 K43 R53 G54 K66 E67 R69 Y75 R109
BS02 rna K P48 R97 P47 R96
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5v93, PDBe:5v93, PDBj:5v93
PDBsum5v93
PubMed28977617
UniProtP9WHD9|RL14_MYCTU Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]