Structure of PDB 5oy0 Chain K

Receptor sequence
>5oy0K (length=80) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
LAQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLAS
KKTFGLPELLATMSFGHILGAGMVLGLASS
3D structure
PDB5oy0 Structure and function of wild-type and subunit-depleted photosystem I in Synechocystis.
ChainK
Resolution2.501 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K L82 S87 L75 S80
BS02 CLA K P64 L67 A68 P57 L60 A61
BS03 CLA K F32 Q42 F25 Q35
BS04 CLA K L76 G79 G83 S87 L69 G72 G76 S80
BS05 CLA K W18 V22 G23 M26 C27 N30 M70 H74 W11 V15 G16 M19 C20 N23 M63 H67
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0016020 membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5oy0, PDBe:5oy0, PDBj:5oy0
PDBsum5oy0
PubMed29414678
UniProtP74564|PSAK2_SYNY3 Photosystem I reaction center subunit PsaK 2 (Gene Name=psaK2)

[Back to BioLiP]