Structure of PDB 5lty Chain K

Receptor sequence
>5ltyK (length=71) Species: 9606 (Homo sapiens) [Search protein sequence]
TKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWF
QNRRAKERKINKKKLQQQQQQ
3D structure
PDB5lty Impact of cytosine methylation on DNA binding specificities of human transcription factors.
ChainK
Resolution2.66 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna K K186 R190 V191 Y193 R198 R228 Q229 I232 N236 K240 K243 K2 R6 V7 Y9 R14 R44 Q45 I48 N52 K56 K59
BS02 dna K Y189 R190 V192 Q235 R238 R242 Y5 R6 V8 Q51 R54 R58
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5lty, PDBe:5lty, PDBj:5lty
PDBsum5lty
PubMed28473536
UniProtQ99626|CDX2_HUMAN Homeobox protein CDX-2 (Gene Name=CDX2)

[Back to BioLiP]