Structure of PDB 5lmn Chain K

Receptor sequence
>5lmnK (length=120) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
VKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPY
AAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIV
DDTPVPHNGCRPKKKFRKAS
3D structure
PDB5lmn Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
ChainK
Resolution3.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K Y20 N26 N27 I29 T31 G37 N38 P39 W42 S44 G45 G46 V47 G52 S53 K55 R85 E92 P113 H116 N117 C119 R120 P121 K122 K123 K124 Y11 N17 N18 I20 T22 G28 N29 P30 W33 S35 G36 G37 V38 G43 S44 K46 R76 E83 P104 H107 N108 C110 R111 P112 K113 K114 K115
BS02 rna K Y25 T87 Y16 T78
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lmn, PDBe:5lmn, PDBj:5lmn
PDBsum5lmn
PubMed27662086
UniProtP80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]