Structure of PDB 5iwa Chain K

Receptor sequence
>5iwaK (length=115) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYA
AQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVD
DTPVPHNGCRPKKKF
3D structure
PDB5iwa Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
ChainK
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K Y20 N26 N27 T31 N38 P39 I40 W42 S44 G46 V47 G52 S53 K55 R85 P113 V114 H116 N117 G118 C119 R120 K122 K123 K124 Y10 N16 N17 T21 N28 P29 I30 W32 S34 G36 V37 G42 S43 K45 R75 P103 V104 H106 N107 G108 C109 R110 K112 K113 K114
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5iwa, PDBe:5iwa, PDBj:5iwa
PDBsum5iwa
PubMed27071098
UniProtP80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]