Structure of PDB 5imq Chain K

Receptor sequence
>5imqK (length=155) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQ
EKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLAL
RWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAY
AHYRW
3D structure
PDB5imq Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome
ChainK
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K S77 R79 N84 Q86 R143 M144 S76 R78 N83 Q85 R142 M143
BS02 rna K A2 R3 R4 R6 R10 N28 M31 R32 D33 G34 K36 N37 L38 I42 R76 R78 R79 R94 S98 R102 R114 R115 A116 A1 R2 R3 R5 R9 N27 M30 R31 D32 G33 K35 N36 L37 I41 R75 R77 R78 R93 S97 R101 R113 R114 A115
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5imq, PDBe:5imq, PDBj:5imq
PDBsum5imq
PubMed27137929
UniProtP17291|RS7_THET8 Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]