Structure of PDB 5gse Chain K

Receptor sequence
>5gseK (length=88) Species: 9606 (Homo sapiens) [Search protein sequence]
ALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAC
EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB5gse Crystal structure of the overlapping dinucleosome composed of hexasome and octasome
ChainK
Resolution3.14 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna K A47 R52 R63 K64 L65 P66 R69 A1 R6 R17 K18 L19 P20 R23
BS02 dna K R72 R83 F84 Q85 R116 V117 T118 M120 R26 R37 F38 Q39 R70 V71 T72 M74
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0045296 cadherin binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0010467 gene expression
GO:0032200 telomere organization
GO:0040029 epigenetic regulation of gene expression
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5gse, PDBe:5gse, PDBj:5gse
PDBsum5gse
PubMed28408607
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]