Structure of PDB 5gap Chain K

Receptor sequence

>5gapK (length=124) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

APNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFI
IMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASI
TTNDASAIKTQIYAVKDKIETLLI

3D structure

PDB

5gap Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.

Chain

Resolution

3.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	Q26 N29 K34 K35 G36 A37 N38 E39 K42 R46 E59 I63 V93 R95 V97 I98	Q24 N27 K32 K33 G34 A35 N36 E37 K40 R44 E57 I61 V91 R93 V95 I96
BS02	rna	K	D22 T112 Q113	D20 T110 Q111

Gene Ontology

	Biological Process
GO:0000245	spliceosomal complex assembly
GO:0000398	mRNA splicing, via spliceosome
GO:0000452	snoRNA guided rRNA 2'-O-methylation
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000494	box C/D sno(s)RNA 3'-end processing
GO:0006364	rRNA processing
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0030490	maturation of SSU-rRNA
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005687	U4 snRNP
GO:0005730	nucleolus
GO:0031428	box C/D methylation guide snoRNP complex
GO:0032040	small-subunit processome
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0071001	U4/U6 snRNP
GO:0071011	precatalytic spliceosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5gap, PDBe:5gap, PDBj:5gap
PDBsum	5gap
PubMed	26829225
UniProt	P39990\|SNU13_YEAST 13 kDa ribonucleoprotein-associated protein (Gene Name=SNU13)