Structure of PDB 5fwk Chain K

Receptor sequence
>5fwkK (length=209) Species: 9606 (Homo sapiens) [Search protein sequence]
IKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCI
VHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVL
LQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPED
DWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISA
FRALQHSYL
3D structure
PDB5fwk Atomic Structure of Hsp90-Cdc37-Cdk4 Reveals that Hsp90 Traps and Stabilizes an Unfolded Kinase.
ChainK
Resolution3.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D140 K142 N145 D158 A170 T177
Catalytic site (residue number reindexed from 1) D54 K56 N59 D72 A84 T91
Enzyme Commision number 2.7.11.22: cyclin-dependent kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP K Y294 L295 Y208 L209
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004693 cyclin-dependent protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity
GO:0030332 cyclin binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0000082 G1/S transition of mitotic cell cycle
GO:0006468 protein phosphorylation
GO:0007165 signal transduction
GO:0008284 positive regulation of cell population proliferation
GO:0009410 response to xenobiotic stimulus
GO:0010389 regulation of G2/M transition of mitotic cell cycle
GO:0010468 regulation of gene expression
GO:0010971 positive regulation of G2/M transition of mitotic cell cycle
GO:0016310 phosphorylation
GO:0048146 positive regulation of fibroblast proliferation
GO:0051301 cell division
GO:0051726 regulation of cell cycle
GO:0060260 regulation of transcription initiation by RNA polymerase II
GO:0061469 regulation of type B pancreatic cell proliferation
GO:0071222 cellular response to lipopolysaccharide
GO:0071353 cellular response to interleukin-4
GO:1904628 cellular response to phorbol 13-acetate 12-myristate
GO:1904637 cellular response to ionomycin
Cellular Component
GO:0000307 cyclin-dependent protein kinase holoenzyme complex
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005667 transcription regulator complex
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005923 bicellular tight junction
GO:0016020 membrane
GO:0031965 nuclear membrane
GO:0097128 cyclin D1-CDK4 complex
GO:0097129 cyclin D2-CDK4 complex
GO:0097130 cyclin D3-CDK4 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5fwk, PDBe:5fwk, PDBj:5fwk
PDBsum5fwk
PubMed27339980
UniProtP11802|CDK4_HUMAN Cyclin-dependent kinase 4 (Gene Name=CDK4)

[Back to BioLiP]