Structure of PDB 5cz2 Chain K

Receptor sequence

>5cz2K (length=36) Species: 11758 (Mouse mammary tumor virus (STRAIN BR6))

LESAQESHALHHQNRFQFHITREQAREIVKLCPNCP

3D structure

• PDB: 5cz2 Cryo-EM reveals a novel octameric integrase structure for betaretroviral intasome function.
• Chain: K
• Resolution: 2.72 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.-
  2.7.7.49: RNA-directed DNA polymerase.
  2.7.7.7: DNA-directed DNA polymerase.
  3.1.-.-
  3.1.26.4: ribonuclease H.
  3.4.23.-
  3.6.1.23: dUTP diphosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	K	H9 H13 C37 C40	H8 H12 C32 C35

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0008270 zinc ion binding

Biological Process

• GO:0015074 DNA integration

External links

• PDB: RCSB:5cz2, PDBe:5cz2, PDBj:5cz2
• PDBsum: 5cz2
• PubMed: 26887496
• UniProt: P03365|POL_MMTVB Gag-Pro-Pol polyprotein (Gene Name=gag-pro-pol)