Structure of PDB 5b3s Chain K

Receptor sequence
>5b3sK (length=49) Species: 9913 (Bos taurus) [Search protein sequence]
APDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWR
3D structure
PDB5b3s Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 K)
ChainK
Resolution1.68 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 DMU K W29 A33 T34 W24 A28 T29
BS02 DMU K T23 Y31 T18 Y26
BS03 DMU K S20 T23 F24 S15 T18 F19
Gene Ontology
Biological Process
GO:0006123 mitochondrial electron transport, cytochrome c to oxygen

View graph for
Biological Process
External links
PDB RCSB:5b3s, PDBe:5b3s, PDBj:5b3s
PDBsum5b3s
PubMed
UniProtP13183|COX7B_BOVIN Cytochrome c oxidase subunit 7B, mitochondrial (Gene Name=COX7B)

[Back to BioLiP]