Structure of PDB 4wfn Chain K

Receptor sequence

>4wfnK (length=113) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence]

HGKAGRKLNRNSSARVALARAQATALLREGRIQTTLTKAKELRPFVEQLI
TTAKGGDLHSRRLVAQDIHDKDVVRKVMDEVAPKYAERPGGYTRILRVGT
RRGDGVTMALIEL

3D structure

PDB

4wfn The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.

Chain

Resolution

3.54 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	H3 G4 K5 A6 G7 L10 R12 S14 A16 R17 R22 I34 Q35 T36 T39 K40 K42 R45 P46 E49 Q50 T53 L60 H61 R63 R64 Q68 H71 K73 R90 P91 G92 G93 R96 R99 R103 R104 G105 D106 G107 V108	H1 G2 K3 A4 G5 L8 R10 S12 A14 R15 R20 I32 Q33 T34 T37 K38 K40 R43 P44 E47 Q48 T51 L58 H59 R61 R62 Q66 H69 K71 R88 P89 G90 G91 R94 R97 R101 R102 G103 D104 G105 V106
BS02	MG	K	H3 K5	H1 K3

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4wfn, PDBe:4wfn, PDBj:4wfn
PDBsum	4wfn
PubMed	28689968
UniProt	Q9RSJ5\|RL17_DEIRA Large ribosomal subunit protein bL17 (Gene Name=rplQ)