Structure of PDB 4ixr Chain K

Receptor sequence
>4ixrK (length=37) Species: 146786 (Thermosynechococcus vestitus) [Search protein sequence]
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
3D structure
PDB4ixr Simultaneous femtosecond X-ray spectroscopy and diffraction of photosystem II at room temperature.
ChainK
Resolution5.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide K P20 D23 V24 L35 R46 P11 D14 V15 L26 R37
BS02 CLA K F37 W39 Q40 F28 W30 Q31
BS03 CA K D19 D23 D10 D14
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ixr, PDBe:4ixr, PDBj:4ixr
PDBsum4ixr
PubMed23413188
UniProtQ9F1K9|PSBK_THEVB Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]