Structure of PDB 4ioa Chain K

Receptor sequence

>4ioaK (length=113) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]

HGKAGRKLNRNSSARVALARAQATALLREGRIQTTLTKAKELRPFVEQLI
TTAKGGDLHSRRLVAQDIHDKDVVRKVMDEVAPKYAERPGGYTRILRVGT
RRGDGVTMALIEL

3D structure

PDB

4ioa Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	H3 K5 A6 G7 R8 K9 L10 N11 R12 N13 S14 A16 A19 L20 R22 E31 I34 Q35 T36 T39 K40 K42 E49 Q50 T53 L60 H61 R64 Q68 H71 K73 R90 P91 G92 G93 R96 R103 R104 G105 D106 V108	H1 K3 A4 G5 R6 K7 L8 N9 R10 N11 S12 A14 A17 L18 R20 E29 I32 Q33 T34 T37 K38 K40 E47 Q48 T51 L58 H59 R62 Q66 H69 K71 R88 P89 G90 G91 R94 R101 R102 G103 D104 V106

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4ioa, PDBe:4ioa, PDBj:4ioa
PDBsum	4ioa
PubMed	23414806
UniProt	Q9RSJ5\|RL17_DEIRA Large ribosomal subunit protein bL17 (Gene Name=rplQ)