Structure of PDB 4il6 Chain K

Receptor sequence
>4il6K (length=37) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
3D structure
PDB4il6 Structure of Sr-substituted photosystem II at 2.1 A resolution and its implications in the mechanism of water oxidation
ChainK
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K P29 L33 P20 L24
BS02 CLA K F32 A36 F37 W39 Q40 F23 A27 F28 W30 Q31
BS03 MG K D19 D23 D10 D14
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4il6, PDBe:4il6, PDBj:4il6
PDBsum4il6
PubMed23426624
UniProtP19054|PSBK_THEVL Photosystem II reaction center protein K (Fragment) (Gene Name=psbK)

[Back to BioLiP]