Structure of PDB 4hx3 Chain K

Receptor sequence

>4hx3K (length=133) Species: 53502 (Streptomyces caespitosus)

PMVTVTYDPSNAPSFQQEIANAAQIWNSSVRNVQLRAGGNADFSYYEGND
SRGSYAQTDGHGRGYIFLDYQQNQQYDSTRVTAHETGHVLGLPDHYQGPC
SELMSGGGPGPSCTNPYPNAQERSRVNALWANG

3D structure

• PDB: 4hx3 Mechanism of action of a Janus-faced single-domain protein inhibitor simultaneously targeting two peptidase classes
• Chain: K
• Resolution: 2.7 Å

Enzymatic activity

• Enzyme Commision number: 3.4.24.77: snapalysin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	K	H83 H87 D93	H84 H88 D94

Gene Ontology

Molecular Function

• GO:0004222 metalloendopeptidase activity
• GO:0008237 metallopeptidase activity
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006508 proteolysis

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:4hx3, PDBe:4hx3, PDBj:4hx3
• PDBsum: 4hx3
• UniProt: P56406|SNPA_STRCS Extracellular small neutral protease (Gene Name=snpA)