Structure of PDB 4bzi Chain K

Receptor sequence
>4bziK (length=164) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
HGKLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSEELAIGNIKFTTF
DLGGHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAEL
KDVPFVILGNKIDAPNAVSEAELRSALGLLNTTGIEGQRPVEVFMCSVVM
RNGYLEAFQWLSQY
3D structure
PDB4bzi The Structure of the Copii Transport-Vesicle Coat Assembled on Membranes
ChainK
Resolution23.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GNP K D32 N33 G35 K36 T37 T38 P53 T54 G76 N132 K133 D135 S172 V173 V174 D10 N11 G13 K14 T15 T16 P31 T32 G54 N110 K111 D113 S147 V148 V149
BS02 MG K T37 T54 T15 T32
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
Biological Process
GO:0000266 mitochondrial fission
GO:0003400 regulation of COPII vesicle coating
GO:0006886 intracellular protein transport
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006998 nuclear envelope organization
GO:0007006 mitochondrial membrane organization
GO:0015031 protein transport
GO:0016050 vesicle organization
GO:0016192 vesicle-mediated transport
GO:0061024 membrane organization
GO:0070863 positive regulation of protein exit from endoplasmic reticulum
GO:1902953 positive regulation of ER to Golgi vesicle-mediated transport
Cellular Component
GO:0000139 Golgi membrane
GO:0005739 mitochondrion
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0012507 ER to Golgi transport vesicle membrane
GO:0016020 membrane
GO:0030127 COPII vesicle coat
GO:0031410 cytoplasmic vesicle
GO:0044233 mitochondria-associated endoplasmic reticulum membrane contact site
GO:0070971 endoplasmic reticulum exit site

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4bzi, PDBe:4bzi, PDBj:4bzi
PDBsum4bzi
PubMed24062940
UniProtP20606|SAR1_YEAST Small COPII coat GTPase SAR1 (Gene Name=SAR1)

[Back to BioLiP]