Structure of PDB 4b3m Chain K

Receptor sequence
>4b3mK (length=119) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYA
AQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVD
DTPVPHNGCRPKKKFRKAS
3D structure
PDB4b3m 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
ChainK
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K R2 Y10 N16 N17 I19 T21 G27 N28 P29 W32 S34 G36 V37 G42 S43 K45 R75 V104 P105 H106 N107 C109 R110 K113 K114 R2 Y10 N16 N17 I19 T21 G27 N28 P29 W32 S34 G36 V37 G42 S43 K45 R75 V104 P105 H106 N107 C109 R110 K113 K114
BS02 MG K N16 G42 N16 G42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4b3m, PDBe:4b3m, PDBj:4b3m
PDBsum4b3m
PubMed24473108
UniProtP80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]