Structure of PDB 3zke Chain K

Receptor sequence
>3zkeK (length=85) Species: 9606 (Homo sapiens) [Search protein sequence]
KAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTW
HCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
3D structure
PDB3zke Structural Analysis of the Regulation of the Dynll/Lc8 Binding to Nek9 by Phosphorylation
ChainK
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide K E35 K36 E31 K32
BS02 peptide K R60 N61 F62 G63 S64 Y65 V66 T67 H68 E69 T70 Y75 Y77 R56 N57 F58 G59 S60 Y61 V62 T63 H64 E65 T66 Y71 Y73
Gene Ontology
Molecular Function
GO:0004857 enzyme inhibitor activity
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0030235 nitric-oxide synthase regulator activity
GO:0036487 nitric-oxide synthase inhibitor activity
GO:0042802 identical protein binding
GO:0044877 protein-containing complex binding
GO:0045505 dynein intermediate chain binding
GO:0060703 deoxyribonuclease inhibitor activity
GO:0097110 scaffold protein binding
Biological Process
GO:0006915 apoptotic process
GO:0006974 DNA damage response
GO:0007017 microtubule-based process
GO:0007286 spermatid development
GO:0021762 substantia nigra development
GO:0035721 intraciliary retrograde transport
GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0042326 negative regulation of phosphorylation
GO:0044458 motile cilium assembly
GO:0045019 negative regulation of nitric oxide biosynthetic process
GO:0110027 negative regulation of DNA strand resection involved in replication fork processing
Cellular Component
GO:0000776 kinetochore
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0005886 plasma membrane
GO:0005929 cilium
GO:0008180 COP9 signalosome
GO:0015630 microtubule cytoskeleton
GO:0016020 membrane
GO:0030141 secretory granule
GO:0030286 dynein complex
GO:0035861 site of double-strand break
GO:0070821 tertiary granule membrane
GO:0072686 mitotic spindle
GO:0097542 ciliary tip
GO:0101003 ficolin-1-rich granule membrane
GO:1904115 axon cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3zke, PDBe:3zke, PDBj:3zke
PDBsum3zke
PubMed23482567
UniProtP63167|DYL1_HUMAN Dynein light chain 1, cytoplasmic (Gene Name=DYNLL1)

[Back to BioLiP]