Structure of PDB 3ow2 Chain K

Receptor sequence

>3ow2K (length=145) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSG
FKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADY
VKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ

3D structure

PDB

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	T1 K3 K4 K5 R6 R8 G9 R11 T12 H13 G14 G16 H18 K19 N20 R21 R22 G23 A24 G25 H26 R27 G28 G29 R30 G31 D32 G34 R35 K37 H38 E39 H41 L46 G47 K48 S49 G50 F51 K52 R53 P54 K56 V57 D65 D70 E71 E99 K107 L109 G110 A111 G112 Q113 R115 S126	T1 K3 K4 K5 R6 R8 G9 R11 T12 H13 G14 G16 H18 K19 N20 R21 R22 G23 A24 G25 H26 R27 G28 G29 R30 G31 D32 G34 R35 K37 H38 E39 H41 L46 G47 K48 S49 G50 F51 K52 R53 P54 K56 V57 D65 D70 E71 E94 K102 L104 G105 A106 G107 Q108 R110 S121
BS02	MG	K	R27 E39	R27 E39

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3ow2, PDBe:3ow2, PDBj:3ow2
PDBsum	3ow2
PubMed
UniProt	P12737\|RL15_HALMA Large ribosomal subunit protein uL15 (Gene Name=rpl15)

[Back to BioLiP]