Structure of PDB 3mq7 Chain K |
>3mq7K (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] |
EAARDGLRAVMEARNVTHLLQQELTEAQKGFQDVEAQAATANHTVMALMA SLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIA |
|
PDB | 3mq7 Structural insight into the mechanisms of enveloped virus tethering by tetherin. |
Chain | K |
Resolution | 2.28 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
K |
E73 E76 |
E23 E26 |
|
|
|
|