Structure of PDB 3mk7 Chain K

Receptor sequence

>3mk7K (length=465) Species: 316 (Stutzerimonas stutzeri) [Search protein sequence]

STAYSYKVVRQFAIMTVVWGIVGMGLGVFIAAQLAWPFLNFDLPWTSFGR
LRPLHTNAVIFAFGGCALFATSYYSVQRTCQTTLFAPKLAAFTFWGWQLV
ILLAAISLPLGFTSSKEYAELEWPIDILITIVWVAYAVVFFGTLAKRKVK
HIYVGNWFFGAFILTVAILHVVNNLEIPVTAMKSYSLYAGATDAMVQWWY
GHNAVGFFLTAGFLGIMYYFVPKQAERPVYSYRLSIVHFWALITVYIWAG
PHHLHYTALPDWAQSLGMVMSLILLAPSWGGMINGMMTLSGAWHKLRSDP
ILRFLVVSLAFYGMSTFEGPMMAIKTVNALSHYTDWTIGHVHAGALGWVA
MVSIGALYHLVPKVFGREQMHSIGLINTHFWLATIGTVLYIASMWVNGIA
QGLMWRAINDDGTLTYSFVESLEASHPGFVVRMIGGAIFFAGMLVMAYNT
WRTVQAAKPAEYDAA

3D structure

PDB

3mk7 The Structure of cbb3 Cytochrome Oxidase Provides Insights into Proton Pumping

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

7.1.1.9: cytochrome-c oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEM	K	E122 Y123 W203 V210 L214 Y251 H257 H258 T321 G324 P325 M327 A328 N333 H337 H345 V346 G349	E117 Y118 W198 V205 L209 Y246 H252 H253 T316 G319 P320 M322 A323 N328 H332 H340 V341 G344
BS02	HEM	K	M29 G32 V33 I35 A36 R57 H60 T61 V64 I65 Y123 I343 V346 H347 A350 L351 Y395 R437 G441	M24 G27 V28 I30 A31 R52 H55 T56 V59 I60 Y118 I338 V341 H342 A345 L346 Y390 R432 G436
BS03	CU	K	H207 H257 H258	H202 H252 H253
BS04	CA	K	A124 L126 D131 N179	A119 L121 D126 N174

Gene Ontology

	Molecular Function
GO:0004129	cytochrome-c oxidase activity
GO:0005506	iron ion binding
GO:0005507	copper ion binding
GO:0008121	ubiquinol-cytochrome-c reductase activity
GO:0015078	proton transmembrane transporter activity
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0019825	oxygen binding
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0006119	oxidative phosphorylation
GO:0009060	aerobic respiration
GO:0015990	electron transport coupled proton transport
GO:0019411	aerobic respiration, using ferrous ions as electron donor
GO:0019646	aerobic electron transport chain
GO:0022904	respiratory electron transport chain
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0070069	cytochrome complex
GO:0098803	respiratory chain complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3mk7, PDBe:3mk7, PDBj:3mk7
PDBsum	3mk7
PubMed	20576851
UniProt	D9IA43\|CCON1_STUST Cbb3-type cytochrome c oxidase subunit CcoN1 (Gene Name=ccoN1)

[Back to BioLiP]