Structure of PDB 3kzi Chain K

Receptor sequence
>3kziK (length=37) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
3D structure
PDB3kzi Crystal Structure of Monomeric Photosystem II from Thermosynechococcus elongatus at 3.6-A Resolution
ChainK
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide K P20 D23 V24 I28 L35 P11 D14 V15 I19 L26
BS02 CLA K F32 F37 W39 Q40 F23 F28 W30 Q31
BS03 BCR K Y15 F18 F32 W39 Y6 F9 F23 W30
BS04 BCR K L21 L31 F32 F37 V38 L12 L22 F23 F28 V29
BS05 CLA K P29 V30 L33 P20 V21 L24
BS06 CA K D19 D23 D10 D14
Gene Ontology
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3kzi, PDBe:3kzi, PDBj:3kzi
PDBsum3kzi
PubMed20558739
UniProtQ9F1K9|PSBK_THEVB Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]