Structure of PDB 3jcm Chain K

Receptor sequence

>3jcmK (length=279) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

PNLELHEDKFLLDLSKFKIYYDNNHGYEWWDTAYLVAHPLPEKIIKAYLT
QHERKRLRRNRRKMAREAREIKIKLGLLPKPEPKVKLSNMMSVFENDQNI
TDPTAWEKVVKDQVDLRKRKHLEENERRHEDAIKRRKEAVNMNVEKPTVY
HCKVFQFKNLQNPKIRFKLKMNSKELSLKGLCLRIRDDGPGIIIVVGNEK
SCKFYENLVMKRIKWNEDFELHTNTGDIKMDMHNNSISKTWEGYLQDCKF
KGWFMKVCNDQDSLLRTLGQFDSEHFYSP

3D structure

PDB

3jcm The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	K242 R246 R253 K271 N276 N312 R315 P350 K351 R353 F354 K355 K357 M358 E362 R399 E407 H409 F441 M442 K443	K55 R59 R66 K84 N89 N125 R128 P163 K164 R166 F167 K168 K170 M171 E175 R212 E220 H222 F254 M255 K256
BS02	rna	K	R241 R246 R249 K273 R304 H308 R315	R54 R59 R62 K86 R117 H121 R128

Gene Ontology

	Molecular Function
GO:0003674	molecular_function
GO:0005515	protein binding

	Biological Process
GO:0000245	spliceosomal complex assembly
GO:0000387	spliceosomal snRNP assembly
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing

	Cellular Component
GO:0005634	nucleus
GO:0005681	spliceosomal complex
GO:0005687	U4 snRNP
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0071001	U4/U6 snRNP

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jcm, PDBe:3jcm, PDBj:3jcm
PDBsum	3jcm
PubMed	26743623
UniProt	Q03338\|PRP3_YEAST U4/U6 small nuclear ribonucleoprotein PRP3 (Gene Name=PRP3)

[Back to BioLiP]