Structure of PDB 3j6b Chain K

Receptor sequence

>3j6bK (length=195) Species: 4932 (Saccharomyces cerevisiae)

KHEYAPRFKIVQKKQKGRVPVRTGGSIKGSTLQFGKYGLRLKSEGIRISA
QQLKEADNAIMRYVRPLNNGHLWRRLCTNVAVCIKGNETRMGKGKGGFDH
WMVRVPTGKILFEINGDDLHEKVAREAFRKAGTKLPGVYEFVSLDSLVRV
GLHSFKNPKDDPVKNFYDENAKKPSKKYLNILKSQEPQYKLFRGR

3D structure

• PDB: 3j6b Structure of the yeast mitochondrial large ribosomal subunit.
• Chain: K
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	K38 H39 P43 R44 F45 K46 I47 Q49 K50 K51 Q52 K53 G54 R55 V56 R59 G61 G62 S63 K65 G66 Q70 R84 Q89 E92 R99 R112 C114 N116 K122 N124 R127 M128 K130 G131 K132 R141 R166 K167 T170 K171 L172 P173 L184 F192 K193 D197 K227 R230	K1 H2 P6 R7 F8 K9 I10 Q12 K13 K14 Q15 K16 G17 R18 V19 R22 G24 G25 S26 K28 G29 Q33 R47 Q52 E55 R62 R75 C77 N79 K85 N87 R90 M91 K93 G94 K95 R104 R129 K130 T133 K134 L135 P136 L147 F155 K156 D160 K190 R193

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j6b, PDBe:3j6b, PDBj:3j6b
• PDBsum: 3j6b
• PubMed: 24675956
• UniProt: P38064|RM16_YEAST Large ribosomal subunit protein uL16m (Gene Name=MRPL16)