Structure of PDB 3i55 Chain K

Receptor sequence
>3i55K (length=132) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLG
DKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDE
NEDPRGTELKGPIAREVAQRFGSVASAATMIV
3D structure
PDB3i55 Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
ChainK
Resolution3.11 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K M1 A3 T9 G11 E13 K14 S16 L17 K30 I32 S33 V34 G36 Y37 S38 G39 T40 K41 N42 R43 H44 T54 S56 R66 R77 K78 R81 R87 M1 A3 T9 G11 E13 K14 S16 L17 K30 I32 S33 V34 G36 Y37 S38 G39 T40 K41 N42 R43 H44 T54 S56 R66 R77 K78 R81 R87
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3i55, PDBe:3i55, PDBj:3i55
PDBsum3i55
PubMed19738021
UniProtP22450|RL14_HALMA Large ribosomal subunit protein uL14 (Gene Name=rpl14)

[Back to BioLiP]