Structure of PDB 3foo Chain K

Receptor sequence

>3fooK (length=106) Species: 562 (Escherichia coli)

ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLED
KSPDSPEMCDFAAGFHILVGQIDDALHLANEGKVKEAQAAAEQLKTTCNA
CHQKYR

3D structure

• PDB: 3foo A superprotein triangle driven by nickel(II) coordination: exploiting non-natural metal ligands in protein self-assembly
• Chain: K
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	K	M7 L10 N11 F65 C98 C101 H102 Y105 R106	M7 L10 N11 F65 C98 C101 H102 Y105 R106
BS02	PXX	K	K42 P53 M58 C59	K42 P53 M58 C59
BS03	PXX	K	D74 H77	D74 H77

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0022900 electron transport chain

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:3foo, PDBe:3foo, PDBj:3foo
• PDBsum: 3foo
• PubMed: 19527025
• UniProt: P0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC)